Web Analysis for Affiliatemarketingacademyreview - affiliatemarketingacademyreview.com
Affiliate Marketing Academy Review is the authority destination for info about make money with affiliate programs in youtube affiliate marketing program - Affiliate Marketing Academy Review is all about the essential make money with affiliate programs information - Get the info you need now....
affiliatemarketingacademyreview.com is 4 years 7 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, affiliatemarketingacademyreview.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | 27 |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 608 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 1 |
H3 Headings: | 2 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 1 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 94.231.104.194)
Sådan får I et bedre parforhold med forståelse gennem parterapi
Når ens parforhold er i kaos, er der brug for parterapi med struktur, overblik og faste spilleregler. Danmarks dygtigste parterapeut, Mikael Hoffmann
CHLEOPATRA - Naturlig og økologisk hudpleje - Stay Natural!
CHLEOPATRA står for holistisk hudpleje med naturlige og rene vegetabilske og æteriske olier samt andre skønne råvarer - alle fri for skadelig og kedelig kemi. Find plejende olier til hud og hår, olier til aromaterapi, mineralsk ler og salt til egne blandinger samt naturlige skin tonics. Naturligvis Økologisk
Dansk Papirisolering ApS - Velkommen
Dansk kvalitets isolering til markedets bedste pris. Papirisolering som granulat og i måtter.
HTTP Header Analysis
Connection: Keep-Alive
Content-Type: text/html
Last-Modified: Wed, 16 Oct 2019 19:42:38 GMT
Accept-Ranges: bytes
Content-Encoding: gzip
Vary: Accept-Encoding
Content-Length: 2014
Date: Mon, 21 Oct 2019 13:39:30 GMT
Server: LiteSpeed
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.azehosting.net | 94.130.138.185 | Germany | |
ns2.azehosting.net | 88.99.15.5 | Germany | |
ns3.azehosting.net | 88.99.39.181 | Germany |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
affiliatemarketingacademyreview.com | A | 3599 |
IP: 94.231.104.194 |
affiliatemarketingacademyreview.com | NS | 3600 |
Target: ns2.azehosting.net |
affiliatemarketingacademyreview.com | NS | 3600 |
Target: ns3.azehosting.net |
affiliatemarketingacademyreview.com | NS | 3600 |
Target: ns1.azehosting.net |
affiliatemarketingacademyreview.com | SOA | 3600 |
MNAME: ns1.azehosting.net RNAME: server-admin.azehosting.net Serial: 2019101304 Refresh: 3600 Retry: 1800 Expire: 1209600 Minimum TTL: 86400 |
affiliatemarketingacademyreview.com | MX | 3600 |
Target: affiliatemarketingacademyreview.com |
affiliatemarketingacademyreview.com | TXT | 3600 |
TXT: v=spf1 +a +mx +ip4:94.231.104.194 include:spf.azehosting.net ~all |
Full WHOIS Lookup
Registry Domain ID: 2443128290_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.1api.net
Registrar URL: http://www.1api.net
Updated Date: 2019-10-13T11:56:05Z
Creation Date: 2019-10-13T11:56:05Z
Registry Expiry Date: 2020-10-13T11:56:05Z
Registrar: 1API GmbH
Registrar IANA ID: 1387
Registrar Abuse Contact Email: abuse@1api.net
Registrar Abuse Contact Phone: +49.6841.6984-200
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.AZEHOSTING.NET
Name Server: NS2.AZEHOSTING.NET
Name Server: NS3.AZEHOSTING.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-10-21T13:39:45Z